Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G069162-GRMZM2G141922
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100191406

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5892206320462
Log2 mRNA fold difference:-1.0889880390146
Log2 TE fold difference:-0.47745987333828
Sequences
Protein sequence

MGHGVSCARTGDEHDYFRAAQVGDLEALEALLDADPSLARRATLYDRLSALHIAAANGRL
EVLSMVLDHGVPPDVVNRHKQTPLMLAAMHGKTDCVLKLLQAGANILMFDSQHGRTCLHH
ASYFGHVGCLQAILTAARTTPVANSWGFARFVNVRDDHGATPLHLAARQGRPGCVQALLE
NGAIVSALTGSYGYGSKVSCSSWLQLLTCTVRRCRFPGSTSLHLAARSGSLDCTRKLLAW
GADRLRRDSAGRIPYAVALKRNHEACAALLNPSAAEPMVWPSPFKFISELEPEAKALLEA
ALTEANREREEKILRGTKHSPHPPTWDHASDAADADAIDDASSDASASDAELCCICFDQA
CTMEVQDCGHQMCAPCTLALCCHSKPDPVTLALPSPACPFCRGSISRLLLVARASSDDAD
TEKSAAAAAAAAASSPQLVRRRSRRSHNLSDGGSSSFKGLSSAVAGSFSKIGRGSSRTMA
DSDGCGVDKPEHDP*

MGHGVSCARTGDEHNYFRAAQVGDLDALDALLAADPSLARRATLYDRLSALHITAANGHL
EVMSMILDHGVPPDAVNRHKQTPLMLAAMHGKIDCARKLLEAGANILMFDSLHGRTCLHH
ASYFGHVDCLRAILAAARTTPVADSWGFARFVNVRDDRGATPLHLAARQGRSACVQVLLE
NGAIVSALTGSYGFPGSTSLHLAARSGNLDCIRKLLAWGADRLQRDSAGRIPYAVALKRN
HAACAALLNPSAAEPMVWPSPLKFISELDPEAKALLEAALMDANREREEKILKGITKYSQ
PSPTSPCEHDAIDEASLEASDGELCCICFEQACSIEVQDCGHQMCAACTLALCCHSKPNP
ATLTPPSPACPFCRGSISRLLVARASPDADDDDKAAAASSPQLVRRRSHNLRWAAATAWT
SPSTTCDRHLMLCVAEQTAEHDHFKS*

Other information
Ka divergence:0.225545KaKs divergence:-0.0411687
GC content 1 (%):69GC content 2 (%):68GC content divergence:-0.007
Length 1 (bp):1485Length 2 (bp):1341Length divergence:-0.051
MFE 1 (kcal):-733.06MFE 2 (kcal):-653.54MFE divergence-0.057