Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G069177-GRMZM2G143211
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5438208880019
Log2 mRNA fold difference:1.1523693111606
Log2 TE fold difference:-2.6933341075582
Sequences
Protein sequence

MSSQVSTSHGLHPPGKLGTFESPHAWPLSAPTAQPEAGRGDDQEVRLLSVAWNQDCGCFA
AGTSNGFRIFNCDPFKETFRRDLKSGGFGIVEMLFRCNILALVGGGSNVQYPPNKVMIWD
DHQSRCIGEFAFRSDVRAVKLAKDYIVIVLERKIFVYNFTDLKLLYQIDTLSNPKGLCCL
SHNSNTSVLACPGVHQGHVRVEHFGLKMAKTISAHDSHISCMSLTMDGLLLATASTKGTL
IRIFNTMDGTRLQEVRRGLDRAEIYSIAVSPNVQWLAVSSDKGTVHIFSLRVRVAGEDAS
NEQRTAESPRMDHQSSSSSIDPLIQANTGSNASSSLSFMRGILPKYFSSEWSFAQFHLPE
VTRYIVAFGAQNTVMMVGLDGSFYRCSFDQVNGGQMLQKEYFRFLKSDSPPLRSAAI*

MSSHVSTSRGLHPPGKLGTLDSPGAWQPPAPMAQPEAGRGDDQEVRLLSVAWNQDCGCFA
AGTSNGFRIFNCEPFKETFRRDLKSGGFAIVEMLFRCNVLALVGGGSNVLYPPNKVIIWD
DLLSRCIGEFAFRSDVRAVKLAKDYIVIVLERKIFVYNFTDLKLLYQIDTLSNPNGLCCL
SHHSNTSVLACPGLHQGHVRVEHFGLQMVKTIPAHDSHISCMSLTMDGLLLATASTKGTL
IRIFNTMDGTRLQEVRRGLDKAEIYSIALSPNVQWLAVSSDKGTVHIFSLRVRVAGVDSS
NEQRALEGPRMDHQNSSSSIDPLIQANTGSNASSSLSFMRGILPKYFSSEWSFAQFHLPE
VTRYIVAFGAQNTVMMVGLDGSFYRCSFDQANGGQMLQREHFRFLKSDSPPFRTAAA*

Other information
Ka divergence:0.287896KaKs divergence:0.464563
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1254Length 2 (bp):1254Length divergence:0
MFE 1 (kcal):-441.6MFE 2 (kcal):-461.61MFE divergence0.022