Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G069208-GRMZM2G049429
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274069
Function (paralog2):PUR ALPHA-1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDGGGGGVGGGGVGAGVMVGGGVGPGGGVGGGGDVELVSKTLQFEHKLFYFDLKENPRGR
YLKISEKTSATRSTIIVPVDGVAWFLDLFDYYIRTDERDAFSKELRLQTKVFYFDIGENK
RGRFLKVSEASVNRNRSTIIVPAGSSGEEGWEAFRSVLLEINNEATRLYVLPNHPNQQHM
EPPERLPGLSDDVGAGFIAGHGSQSASGPEVDVERLVDLPPQEEISGMGMSKVIRADQKR
FFFDLGSNNRGHYLRISEVAGADRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMTGANV
RTVEPSQR*

MDGGGGGGGGGGGVGAGVMVGGGVVPGGGGGDVELVSKTLQFEHKLFYFDLKENPRGRYL
KISEKTSATRSTIIVPIDGVAWFLDLFDYYIRTDERDVFSKELRLQTKVFYFDIGENKRG
RFLKVSEASVNRNRSTIIVPAGSSGEEGWEAFRNVLLEINNEASRLYVLPNHPNQQHMEP
PERLPGLSDDVGAGFIAGHGSQSASGPEVDVERLVDLPPQEEISGMGMSKVIRADQKRFF
FDLGSNNRGHYLRISEVAGVDRSSIILPLSGLKQFHEMVGHFVDIMKDRLEGMTGANVRT
VESSQR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):55GC content 2 (%):53GC content divergence:-0.019
Length 1 (bp):927Length 2 (bp):921Length divergence:-0.003
MFE 1 (kcal):-360.9MFE 2 (kcal):-337.42MFE divergence-0.034