Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G069410-GRMZM2G075900
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):H+-translocating pyrophosphatase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7016717114037
Log2 mRNA fold difference:-2.9239937910155
Log2 TE fold difference:1.2050700448502
Sequences
Protein sequence

MEGGNILFKGEHFPPGERFPTWDGISTRWLLYTEQAPSAWLNFALCGLVGIVTAYAFVWI
SKYYTDYKHEPVRLLALSSSTGHGTNIIAGVSLGMESTALPVLVISVAIISAYWLGQTSG
LVDESGNPTGGLFGTAVATMGMLSTAGYVLTMDMFGPIADNAGGIVEMSQQPESVREITD
VLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVASFAQLPFKEVDIAVPEIFVGGLL
GSMLIFLFSAWACSAVGKTAQEVVKEVRRQFIERPGIMDYKEKPDYGRCVAIVASASLRE
MIKPGALAIISPMAVGVVFRILGHYTGQPLLGAKVVASMLMFATVAGILMALFLNTAGGA
WDNAKKYIETGALGGKGSESHKAAVTGDTVGDPFKDTAGPSLHVLIKMLATITLVMAPIF
L*

MRANSYPIMMEEDMENGRSYQERPRAFSTVRSKSSVPLAFRLLMRVNPRAVIILSLLVFS
GVLYVGASTSPILVFVFCICTLSLFFSVYLTKWVLAKDEGPPEMSEISDAIRDGAEGFFR
TQYGTISKMAFILAFVILGIYIFRTTTPQQEASGLGRATLAYITVASFLLGALCSGIAGF
VGMWVSVRANVRVSSAARRSARESLQIAVRAGGFSAIVVVCMAVFGVAILYSTFYVWLGV
DSPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPR
NPAVIADLVGDNVGDCAARGADLFESIAAEIISAMILGGTMAQRCKIEDPSGFILFPLVV
HSFDLVVSSVGILSIRGTRDSGLISPIEDPMAIMQKGYSVTIMLAVLTFGVSTRWLLYTE
QAPSAWLNFALCGLVGIITAYAFVWISKYYTDYKHEPVRLLALSSSTGHGTNIIAGVSLG
MESTALPVLVISVAIISSYWLGQTSGLVDESGNPTGGLFGTAVATMGMLSTAGYVLTMDM
FGPIADNAGGIVEMSQQHESVREITDVLDAVGNTTKATTKGFAIGSAALASFLLFSAYMD
EVASFAQMPFKEVDIAVPEIFVGGLLGSMLIFLFSAWACSAVGKTAQEVVNEVRRQFIER
PGIMDYKEKPDYGRCVAIVASASLREMIKPGALAIISPMAVGVVFRILGHSTGQPLLGAK
VVASMLMFATVAGILMALFLNTAGGAWDNAKKYIETGALGGKGSESHKAAVTGDTVGDPF
KDTAGPSLHVLIKMLATITLVMAPIFL*

Other information
Ka divergence:-0.588465KaKs divergence:-0.496383
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1266Length 2 (bp):2424Length divergence:0.314
MFE 1 (kcal):-418.72MFE 2 (kcal):-797.05MFE divergence0.311