Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G069528-GRMZM2G171108
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.9842996288432
Log2 mRNA fold difference:-3.0942176651367
Log2 TE fold difference:0.19250315972359
Sequences
Protein sequence

MGADRFLSVAEGGLGGEALYFAVILWLSVMSWIIFTWVGDGGEDGRRGRKRRGSRGSPVF
VGASGICDGTGPECSGGYGICGTCLD*

MGADRFPSVAEGGLGGEALYCAVILWLSVTSWIIFTWAGDGGEGGRRRRGGGRSRGSPAF
VGASGLCDGTGPECSGGYGICGTCLD*

Other information
Ka divergence:0.600141KaKs divergence:0.267087
GC content 1 (%):72GC content 2 (%):74GC content divergence:0.014
Length 1 (bp):261Length 2 (bp):261Length divergence:0
MFE 1 (kcal):-136.3MFE 2 (kcal):-137.7MFE divergence0.005