Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G069649-GRMZM2G481452
Species:maize
Duplication type:WGD
Function (paralog1):F-box family member
Function (paralog2):hypothetical protein LOC100279520

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.61090916008209
Log2 mRNA fold difference:-0.4866684584219
Log2 TE fold difference:1.0665892814777
Sequences
Protein sequence

MPALYAYGDDGCLVSAPAELAGLFCRGAVQQRKRTLVAASAVAAAAAECVRAAKKQRQLP
SLDALPDECLFEILRRVPGRRGAAACVSRRWLALLGSIRVSEFGQAAAAADTPSLPDLNE
EFVMEEDKEEVPADRCVDRVLEGKEATDVRLAAMAVVAGSCGGLEKLSVRGSHPARGVTD
QGLSAVARGSPNLSSLALWDVPLITDAGLVEIAAGCPLLERLDISRCPLITDKGLAAFAQ
GCPDLVSLTIEACSSVGDEGLRAIGRSCMKLQAVNIKNCPLVGDQGISSLVCSATASLAK
IRLQGLNITDASLAVIGYYGKAITDLSLTRLATVGERGFWVMANAAGLQNLRCMSVTSCP
GVTDLALASIAKFCPSLKKLYLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTLVGIL
AFLNCSQKFRALSLVKCMGIKDICSVPQLPFCRSLRFLTIKDCPGFTNASLAVVGMICPQ
LEQVDLSGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSL
EGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLASARHLKLRVLSLSGCSKVTQ
KSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA*

MRCHAPGLLVRLGNGDGCNGRGRSVVSSTIPTEVPLLLPSFASFFSPVAGGDRVPFFLLR
RAVNASGPLRRSRSGGDRAPVRSPGLDSIGRGRGSFGLGKFEDMPALYAYYGDGGCLVSA
PAELAGLFCRGAVQQRKRTLVTASAVAAAAAEFVRAAKKQRQLPLPSLDALPDECLFEIL
RRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAAADTPSLPDLNEEFVMEEDNEES
PADRCVDRVLEGKEATDVRLAAMAVVAGSRGGLEKLAVRGSHPTRGVTDQGLSAVARGSP
NLSSLALWDVPLITDAGLAEIAAGCPSLERLDICRCPLITDKGLVAVAQGCPNLVSLTIE
ACPGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGISSLVCSATAALTKIRLQGLNITDA
SLAVIGYYGKAITDLTLTRLAAVGERGFWVMANAAGLQNLRCMSVTSCPGVTDLALASIA
KFCPNLKQLYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSLVGILAFLLNCREKFR
ALSLVKCMGIKDICSAPAQLPLCRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDLSGL
GEVTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDA
ILFTMSESCTELAELNLSNCMVSDYGVAILASARHLKLRVLSLSGCSKVTQKSVLFLGNL
GQSIEGLNLQFCDMIGNHNIASLEKKLWWCDILA*

Other information
Ka divergence:0.0038182KaKs divergence:0.248654
GC content 1 (%):57GC content 2 (%):58GC content divergence:0.009
Length 1 (bp):1932Length 2 (bp):2265Length divergence:0.079
MFE 1 (kcal):-827.32MFE 2 (kcal):-992.1MFE divergence0.091