Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G070199-GRMZM2G010348
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383938
Function (paralog2):Cytochrome c

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAG
NKNKAVVWEEDTLYEYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATA*

MASFSEAPPGNPKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTTGYSYSAG
NKNKAVIWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKEATA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):339Length 2 (bp):339Length divergence:0
MFE 1 (kcal):-119.8MFE 2 (kcal):-115.69MFE divergence-0.017