Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G070218-GRMZM2G161566
Species:maize
Duplication type:WGD
Function (paralog1):shikimate kinase
Function (paralog2):shikimate kinase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.3182631910199
Log2 mRNA fold difference:-0.24934552539649
Log2 TE fold difference:1.8045620266178
Sequences
Protein sequence

MEAGGVGLALQARAAGFGSSRHRGGLQAPTGSLRVADPAGPAVAVRARGSKPVAPLRLRA
KKSSGGHENSHNSVDEALLLKRKSEEVLFYLNGRCIYLVGMMGSGKSTVGKIMSEVLGYS
FFDSDKLVEQAVGMPSVAQIFKVHSEAFFRDNESSVLRDLSSMRRLVVATGGGAVIRPIN
WRYMKRGLSVWLDVPLDALARRIAKVGTASRPLLDQPSGDPYAMAFSKLSMLAQQRGDAY
ANADVRVSLEEIACKQGHDDVSKLTPTDIAIESLHKIESFVIEHTADSSASDAQAESQIQ
RIQTL*

MEAGGVGLALQTRAAAFGSGQRRGGLQSPIGRLRVAEPAGAAVAVRVRGSKPVVPLRAKK
SSGGHENLHNSVDEALLLKRKSEEVLFYLNGRCIYLVGMMGSGKSTVGKIMSEVLGYSFF
DSDKLVEQAVGMPSVAQIFKVHSEAFFRDNESSVLRDLSSMRRLVVATGGGAVIRPVNWK
YMKKGLSVWLDVPLDALARRIAKVGTASRPLLDQPSGDPYTMAFSKLSMLAEQRGDAYAN
ADVRVSLEEIASKQGHGDVSKLMPTDIAIESLHKIESFVIEHAADNPASDSQAESQIQRI
QTL*

Other information
Ka divergence:-0.233849KaKs divergence:-0.472975
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):918Length 2 (bp):912Length divergence:-0.003
MFE 1 (kcal):-349.1MFE 2 (kcal):-344.54MFE divergence-0.007