Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G070315-GRMZM2G134389
Species:maize
Duplication type:WGD
Function (paralog1):tyrosine specific protein phosphatase family protein
Function (paralog2):tyrosine specific protein phosphatase family protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.77072384563177
Log2 mRNA fold difference:0.11889915804653
Log2 TE fold difference:0.65472029023255
Sequences
Protein sequence

MKLEVMPKPKQRVLEAQQREEAMEMSGLDLWKHEKPPRICPLPPSLPPPPPAFDEAALVP
PLNFAVVDDGIFRSGFPGTANFRFLKSLNLRSIVYLCPEPYPGTNTEFLEKNGIRLHQFG
IEGRKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTGCVVGCLRKLQEWCLSSV
LDEYHRFAAAKARITDQRFMELFDVSSLKHLTPSHC*

MKLEVMPKQRVLEAEQREEAMEMSGLDLWKHEKPPRICSLPPPLPAPPACDEAALVPPLN
FAMVDDGIFRSGFPETANFRFLKSLNLRSIVYLCPEPYPETNTEFLEKNGIRLHQFGIEG
RKEPFVNIPDDKIREALKVVLDPRNQPLLIHCKRGKHRTGCLVGCLRKLQKWCLSSVFDE
YHRFAAAKARITDQRFMELFDVSSLKHLTPSHC*

Other information
Ka divergence:-0.849335KaKs divergence:-0.825123
GC content 1 (%):59GC content 2 (%):57GC content divergence:-0.017
Length 1 (bp):651Length 2 (bp):642Length divergence:-0.007
MFE 1 (kcal):-255.5MFE 2 (kcal):-258.9MFE divergence0.007