Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G070389-GRMZM2G125149
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193521
Function (paralog2):trafficking protein particle complex subunit 3

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.25873312149226
Log2 mRNA fold difference:0.52264020907616
Log2 TE fold difference:-0.26448834367536
Sequences
Protein sequence

MPPAPKSGDALFASVDRVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMKSFTFRGYN
IGTRLVDEFLAKSNVSRCVDFKETADVIAKLGFKMFLGVTATVTNWDAEGTSCSLVLEDN
PLVDFVELPDTCQGLQYCNLLSGVIRGALEMVSMKAEVTWVRDMLRGDDAYEMRVKLIKQ
VPEEYPYKDDD*

MPPAPKSGDALFASVDRVVSRCSRRPDADARSGLGLVVIALLVHRLQNAELFTLTYGAIV
RQLLTDLEEVEEVNKQLDQMGYNIGTRLVDEFLAKSNVSRCVDFKETADVIAKLGFKMFL
GVTATVTNWDVEGTSCSIVLEDNPLVDFVELPDTCQGLQYCNLLSGVIRGALEMVSMKTE
VTWVRDMLRGDDAYEMRVKLIKQVPEEYPYKDDD*

Other information
Ka divergence:0.33374KaKs divergence:0.335628
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):576Length 2 (bp):645Length divergence:0.057
MFE 1 (kcal):-196.4MFE 2 (kcal):-216.4MFE divergence0.048