Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G070716-GRMZM2G004172
Species:maize
Duplication type:WGD
Function (paralog1):NADH-ubiquinone oxidoreductase B16.6 subunit
Function (paralog2):NADH-ubiquinone oxidoreductase B16.6 subunit

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTESLVRNKPGMASIKEMPVLQDGPPPGGFAPVRYARRIPTSGPSATAIFLTAFGAFAYG
MYQVGQGNKVRRALKEEKIAARSAILPMLQAEEDERFVKEWKKYLEEEARIMKDVPGWKV
GESVYNSGKWMPPATGELRPEVW*

MTESLVRNKPGMASIKEMPVVQDGPPPGGFAPVRFARRIPTSGPSATAIFLTTFGAFAYG
MYQVGQGNKVRRALKEEKIAARSAILPMLQAEEDERFVKEWKKCLEEEARIMKDVPGWKV
GESVYNSGKWMPPATGELRPEVW*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):60GC content 2 (%):61GC content divergence:0.008
Length 1 (bp):432Length 2 (bp):432Length divergence:0
MFE 1 (kcal):-174.1MFE 2 (kcal):-177.9MFE divergence0.011