Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G070849-GRMZM2G134279
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274036
Function (paralog2):hypothetical protein LOC100272451

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.46042081180922
Log2 mRNA fold difference:1.1347110594024
Log2 TE fold difference:-0.8842243272846
Sequences
Protein sequence

MDMAHERSDASSEEEVMAGELRRGPWTVEEDLQLVNYVDAHGEGRWNSLARSAGLKRTGK
SCRLRWLNYLRPDLRRGNITPQEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTR
VQKHAKQLKCDVNSQQFKDVMRYLWMPRLVERIQAAAANNNASGAGVPPAGAAADDTPLS
SSWQHGGGADDDGGLYASPELPTDACWPPADCYYYPAAADHQLLNNPAAAAVFPDLSSTT
AGSSSPSSDSGAGTAQPWPAPLGGAEWLTTGACCDASSAAAALGGQQQQSCLVGETSWAS
SELPELGVADFEIGSFDVESIWSMDDSLWFTQAQGV*

MDMAHERDASSEEEVVAGELRRGPWTVEEDLLLVNYVAAHGEGRWNSLARSAGLRRTGKS
CRLRWLNYLRPDLRRGNITPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRV
QKHAKQLKCDVNSQQFKDVMRYLWMPRLVERIQNAGAAGAPQQHKAGAADTPLSSPSSWQ
PGGGGGADDGLYASPDLPATDACCWPPADCYPAAAAAAVGDGDHHHQLLMNNPAAVPELS
ASTTTAGSASPSSDSGAGAQPCWLAPVGGAEWFTTTCDASSSTAAVLLAGHQQQQQQQQW
SCLLGEATWASSSELPDLGCVADFEIGSFDVESIWSTDDSLWFTQAQGV*

Other information
Ka divergence:-0.0729648KaKs divergence:0.356765
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):1011Length 2 (bp):1050Length divergence:0.019
MFE 1 (kcal):-488.12MFE 2 (kcal):-533.3MFE divergence0.044