Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G070943-AC203571.3
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381745
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRCKLHPYANAVGVCAACLRDRLLALAAERAQAAAEASSDGGYGSSSSSPPPLHLPARRH
RQHGHDEARTGTFPRSVSPYVQRRRSDACAYYATSSSSSSSSAYQHQPSLLFFRTPQVGP
AFRGDEPGDGEDTGGGSRRKQAAPRRSFLSAIFGGRLRRRHGREREEAGRNRKEPPRRST
SWLSAITRRKRRPGEEPESFPAPQDEEPESPGGGSWWFPSPSPARQQHRRRHGAGSGASG
DGVSGLAVCLSPLVRPSSAGGRRRCQPPDPSALGDSHRRLASFGRNASRKLADMGRLR*

MRCKLHPYANPVGVCAPCLRDRLLALAAERAQAAEASSDGGCGSSSCGSPPPPLHLHLPT
RARRHQQHGHAEGRAGGFPRSVSPYAQHRRSDACASSGSGYQPNLLFFRTPQVGPAAAAF
RADEPGEETGGGGGKRKAAPRRSFLSAIFGVRRHGRREEAVVRKDPPRRSTSWLSAIIRR
KRRPADLPAAASFPDEEPESPGGSNSTGSWWFPSPSPARQQQHRRRHGGGAGASGDGISG
FAVCLSPLVRPSSAGGRRRCQPPDPSALGGDSHRRHASAGGAASFGRNASRKLADMGRFR
*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):76GC content 2 (%):75GC content divergence:-0.007
Length 1 (bp):897Length 2 (bp):903Length divergence:0.003
MFE 1 (kcal):-494.1MFE 2 (kcal):-499.1MFE divergence0.005