Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071034-GRMZM2G124476
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192020
Function (paralog2):hypothetical protein LOC100191185

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.92209348410002
Log2 mRNA fold difference:-0.73764581688854
Log2 TE fold difference:-0.19144416418323
Sequences
Protein sequence

MEGTAAARKRSRPETANGAAAAGKRSKDTESFQTGLSSKSKPCTKFFSTIGCPFGEGCHF
LHFVPGGYPAVAKMLNLSSSAVSAPSRTHVDHAALTGASHPASTVKTRMCTKYNTTEGCK
FGDKCHFAHSERELAKPAYMSQEGPPMGGRYGRAEPMQPAAMGPPAGNFGASATAKISVD
ASLAGGIIGKGGVNTKQISRITGVKLSIRDHESNPNLKNIELEGNFDQIKQASDLVRDLI
ATISASMPAKNPSAAAAPAGGGRGGGPGGKSSNYKTKLCENFLKGACTFGDRCHFAHGET
EQRRGAA*

MEGNVAAGKRSRTETANGAAGGGKRSKDMESFQTGLSSKSKPCNKFFSTIGCPFGEGCRF
LHFVPGGYPAVAKMLNLGSPAVSAPSRTHVDHAALTGTSHSASSGKTRMCTKYNTTEGCR
FGDKCHFAHSERELGKPAYMPYGEPPMGGRFGGRPEPVQPAAMGPPAGNFGASATAKISV
DASLAGGIIGKGGVNTKQISRVTGVKLCIRDHESSPNLKNIELEGNFDQIKQAGEMVRDL
IATISTSMPAKNSSAAVAPAGGRGGGLGSKSNYKTKLCENFAKGACTFGERCHFAHGENE
QRSGAV*

Other information
Ka divergence:0.447821KaKs divergence:0.592045
GC content 1 (%):55GC content 2 (%):55GC content divergence:0
Length 1 (bp):924Length 2 (bp):921Length divergence:-0.002
MFE 1 (kcal):-347.6MFE 2 (kcal):-351.04MFE divergence0.005