Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071172-GRMZM2G118022
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100383691

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0109487906049
Log2 mRNA fold difference:-1.5238069733781
Log2 TE fold difference:0.49980118862638
Sequences
Protein sequence

MEDELEKLMLLKKFPNDEVQRRKADLGIDVSLDTISEHTNKSTDNSYHQAGISTPSTPSM
DYGVLNYTEEYNLESVLVNFLGEIYSCHNECPHSDCKNKNELCPSLKSLIHKKVNELNNL
PHNIGRGQSQEGSDAKPSDQNNLYNTMAAQSKQFKDALEILGSNSELFVKLLQKPNQHIA
DSIQQHENSKVSAGLEPDKIHGQTNFVGGRGSSKQHPLATKEQAKERKYMFFWRKSKSNR
RQMLDATDGAQTVSKIVILKPNPERGINQKAATARTLHQQPCTSNAPGCSGRENSKFSIK
EVKKRFRFVTGERSERNLSPAEDLQGDPRKIKDSVVAINKYFRHLPEGSLANKSASDIEN
GIKPFISSKQKNQNGSITEISGHIVAPKGASVFYEEARRHLSEMLKGNDCSINYPEVQIS
KSLEGILSLPHGNVSTTGSSLRGKDYLDPSPGETDVYDACEVEREECTQERSQSQEDFGS
IAHCTCTTVDDQVTVREGYYTNEAQEGPRHAHDEPDTLYIEGLDKFICRENIRNEESSPA
EQSRDDIRQEILEEINQGKEHVKMSLASVEGIDEKLGQQEPETPEPRASAKLISDGSPNQ
SDEKQERPSPVSVLESSFEDIGSPDCINKKECKSKRKNLINIIQLY*

MGRRGHGGSASQDDDGVGCAWGLMRMLYFRRDPKLLLDAKQLSGRHAFREVSERGHSAKR
SKDFDEIEEDGNIEECTSQKPTVKNLMEDELGKVKLLKKNPNDEIQRRLVDLGNDVSLGR
SSEHTNKSIDRSYHQAGISTPSIPPMDSGVLNYAEEYDLESVLMNFLGEIYSCHDECPHS
DCKNKNELCPSLKSLIHKKVNELNNLPRNIGCAQSQEGNDAKLSDQNNLSNTMAARSKQF
KDALEILGSNNELFMKLLQKPNQHIVDSIQKHENSKVAAGLEPNKIHGQTNFLVGRGGSR
QHPLATKEQAKERKYMFFWRKGKSNRRQMLEATDTDQTVTKIVILKPNPERGFNQKAATA
RTLHQQPCTSHAPECGGIDNSKFSIKEVKTRFRFVNSESRRESNLAPAEDLQGYPRKFKD
SFVAINKDFRHFPEGSLANKSGSDIKNAIKPFISSKQNGSISGNSGHIVAPKGASIFYEE
ARRHLSEMLKDNDCSVNYPAVQISKSLEGILSLPHGNVSTPRSSLWGKDYLGPSPGETDV
FVACEVQREECTQERSQSQEDFGSIARCTSAAVDDQVTVRDGYYTNEAQEGSRHAQNEPG
LLYTEGIHKFICGKNICDEQSVPAEQSRHDVCQEILEEIKQGKEHIKMSPTSAEGIVETL
GQQEPETPEPRASTELISDGSPEQSDEKQERPSPVSVLESFFEDIDNPDCINKKECELHG
LQRTLYFPDNEPDVSLLGEDRSVRVDYIKLVLELSELCAEQNLEVWYLEDELISPCLFEE
LQSQGDQTDDLKLLFDCICEALTEIQERYFRLSWLTFLKQDIRTPPIGENLITEVDRYVY
GYIQHSLPITLEQIIKRDLEVQTWMNIRSKTEGIIMEMWEFVLDELIDETVFDLWI*

Other information
Ka divergence:0.00241255KaKs divergence:0.136191
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):1941Length 2 (bp):2691Length divergence:0.162
MFE 1 (kcal):-529.28MFE 2 (kcal):-790.33MFE divergence0.198