Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071277-GRMZM2G044537
Species:maize
Duplication type:WGD
Function (paralog1):RING zinc finger protein-like
Function (paralog2):RING zinc finger protein-like

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGFPVGYSESEMLLPRVLLQVLLLLGHFHRFLLWAFHAVGLGDLIDLGCNYPPPSASTAQ
EMMEHQHQGRDDVASPLQHQRPEFRPVAAALIEEALPVVRFDELCGAACGGGDCAVCLGG
IGGGDEVRRLGNCRHAFHRACLDRWMAHDQRTCPLCRAPLIPWAADADYDMSYPSPLPPT
PLRRPHELLLLLTGLGGFQ*

MGFPVGYSDSETLLPRVLLQALLLLGHLHRFLLWAFHAVGLGDLIDLGCNYPPPPPSAST
AAAAQEGRDVAAPLRHWRPEFRPVPAVRIEEALPVVRFDELAAAARGDGYGDCDCDCAVC
LDGIGGGDEVRRLGNCRHAFHRACLDRWMAHGQRTCPLCRAPLVPGAAAAGDPWAEAPWL
DAADYDVLPYPSTPLLMVPTPTLLRPHELLLVAGLGGGFQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):73GC content 2 (%):75GC content divergence:0.014
Length 1 (bp):600Length 2 (bp):663Length divergence:0.05
MFE 1 (kcal):-313.22MFE 2 (kcal):-359.43MFE divergence0.069