Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071292-GRMZM2G071374
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100381690

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.55572813576666
Log2 mRNA fold difference:0.09795765755514
Log2 TE fold difference:-0.81615830287445
Sequences
Protein sequence

MAATYQIGLVAEPQLLNTEIITQRATSFVADANKKDKCIGYLDVFVHQARDIHNVCIYHK
QDVYAKLCLTSSPDVSCSTKVINSAGRNPVFEESLRLDVQTADASLKCEIWMLSRVRNYL
EDQLLGFALVPLADIVMGDGKLVQEFSLTSTDLFHTPAGFVKLSLSYAGCSPDVILVPSP
NKSLSEVDGSGNDHVVHSQLEKIVFPDLNVEKEDEIMVSKYLEMESLDSENPIEVENGML
LHSGNNDDVPSRLGKVEFTDSENPAKDENGKLTRFGVAVPDTAGKAEGHHNESPLSCVST
TGSFTTLYATTQSFSEPNSEPSETNVEASPRQCHREKSQDVTDGEADSSETPPKDEVIKP
VISVNLQPEQSVVEQDIVDMYMKSMQQFTESLAKMKLPLDVENRCPSDEGSYSSTIEKAS
PSPPSSASKGSRVFYGSRAFF*

MAATYQIGLVAEPQLLNTEIITQRATSFVADANKKGKCIGYLDVFVHQARDIHNVCIYHK
QDVYAKLCLTSSPDVSCSTKVINSAGRNPVFEESLRLDVQTADASLKCEIWMLSRVRNYL
EDQLLGFALVPLADIVMGDGKLVQEFSLTSTDLFHTPAGFVKMSLSYAGCSPDVILVPSP
NKSLSEVDGSGNDHVVHSQLEKIVFPDLNVEKEDEIMVSKYLEMESLDSENPIEVENGML
LHSGNNDDVPSTLGKVESTDSENPAKAANGKLTRFGVAVPDTAGKAEGHHNESPLSCVST
TVSFTTLYATTQSFSEPNSEPSETNVEASPRQCHREKSQDVTDGEADSSETPPKDEVIKP
VISVNLQPEQSVVEQDIVDMYMKSMQQFTESLAKMKLPLDVENRCPSNEGSYSSTIEKAS
PSPPSSASKGSRVFYGSRAFF*

Other information
Ka divergence:0.440544KaKs divergence:0.445787
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1326Length 2 (bp):1326Length divergence:0
MFE 1 (kcal):-421.52MFE 2 (kcal):-424.41MFE divergence0.003