Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071307-GRMZM5G829396
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383884
Function (paralog2):hypothetical protein LOC100278136

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.8996082567978
Log2 mRNA fold difference:0.99200150164884
Log2 TE fold difference:-2.916016628043
Sequences
Protein sequence

MKADAPATPCRKPAPLPPPPALLAVRARSRSRVADLGFGAAFPGGPPDTPPRRSPVTVPF
LWEEAPGKPKAPPPPTAAAPAATNAGPVPEGGGGGGDDEQHDDQARPVPVPLKLPPRLQQ
VASFAAADTPLLPSPKAVLQGPYYYGCAGDGSRRPPPRWFRSGGAFRRTPSAGVGLFSRT
WSKPAPAPAPASGKSRHGDDHERDAAGPDAPWCSPASSSSSSSVSTCFGGDEHGRGKPCA
DGREVSSEEDGGSPPRGSVRITRLRRNRSLPSVTTSNLWASIRRSFEQITPWSYKFGRSR
PPGANATE*

MDADAPATATPSRKPASHSLPPPPALFAARARSRVADLGAGAAFPAPPPDTPPRRSPITV
PFLWEEAPGKPKALPAAATPAAANAGSFTEVAGRRQDRGHADLPRPLPLKLPPRLQQAAS
SFAAADTPLSPKTVLQGGRRRPRWARRGASAFRRTPSAGGGLFSRNWSKPTAAASNKNGD
GDHERDAAGPDAPWCSPASSSSSSSASTCFGVDGHGHGGRARPADGREVCSEEDDGSPRG
SVRITRFRRNRSLPSMTTSNLWASIRRSVKQITPWS*

Other information
Ka divergence:-0.0344149KaKs divergence:-0.52231
GC content 1 (%):74GC content 2 (%):72GC content divergence:-0.014
Length 1 (bp):927Length 2 (bp):831Length divergence:-0.055
MFE 1 (kcal):-534.11MFE 2 (kcal):-414.94MFE divergence-0.126