Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071378-GRMZM2G147446
Species:maize
Duplication type:WGD
Function (paralog1):integral membrane protein like
Function (paralog2):integral membrane protein like

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.8232573801515
Log2 mRNA fold difference:-1.22876652723
Log2 TE fold difference:0.49413686759456
Sequences
Protein sequence

MSALKKSDKKAALDFAAWSFNVTTSVGLIMVNKALMATYGFSFATTLTGLHFVTTTLMTI
VFRWLGLSQPSHLPLADLVKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEV
VFDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFLQRK
YSLNSFNLLGHTAPAQAGSLLLVGPFADYLLTGKRVDHFSFSSLALFFLALSCFIAIGVN
LSQFICIGRFSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNA
SAKPGGKERRSVLPLRSASLKGSSEEKGGAEK*

MSTLKKSDKKAALDFAAWSFNVTTSVGLIMVNKALMATYGFSFATTLTGLHFVTTTLMTI
LFRWLGLSQPSHLPLADLVKFVIFSNLSIVGMNVSLMWNSVGFYQIAKLCMIPASCLLEV
VFDHVHYSRDTKLSIMVVLIGVAVCTVTDVSVNARGLIAAVIAVWSTALQQYYVHFLQRK
YSLNSFNLLGHTAPAQAGSLLLVGPFADYLLTGKRVDQFSLSSLALFFLALSCFIAIGVN
LSQFICIGRFSAVSFQVLGHMKTVLVLSLGFLFFGKEGLNLQVVLGMVLAVLGMIWYGNA
SAKPGGKERRSILPVRSASLKGSSEEKAGAEK*

Other information
Ka divergence:-0.012951KaKs divergence:0.122248
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):999Length 2 (bp):999Length divergence:0
MFE 1 (kcal):-325.4MFE 2 (kcal):-326.89MFE divergence0.002