Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071491-GRMZM2G099187
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280226
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.59389774098694
Log2 mRNA fold difference:-0.098434587407627
Log2 TE fold difference:-0.4972508831022
Sequences
Protein sequence

MNGTHPWASMSGGPCSNLGYARDMNGNVPISTTNSSGPSIGVSSLVTDANSSLSGGAQLQ
PSTSMNGDSLMRVPASPISFSSNNISGSSVIDGCIMQQSPPQEQVQKQRSSSVTSQPVID
AGGALHAQKKSRIDVCQGGITEQQLIQQLLHGQNSLHYQGQQNPQLQALMQHHKLAQLQQ
RQQQHPFSQMQQPQVGIPRQPQLRPPLAQTGMQLGGPVRSPIESGICSRRILQYLYHKRH
RPENNPITYWRKLVEEYFAPRARERWCVSSYENRGNSSAAAPQKALDTWRCGICNTHGGK
GYEVTYEVLPRLCQIRFDHGVIDEYLYFDSPNEFRLPNGQMVLEHAKVVQKSVYEHLHVI
HEGHLRIIFTPELKIMSWEFCSRRHEEYTTRKTIAPQVNNLLQVAQKFQAVVSESGSAGI
SNNDAQTICNMFVNASRQLAKNLEHHTLNEHGLSKRYVRCLQISEVVNHMKDLIEFSHKS
KLGPKESLNSYSKTTAKFENMHDSRQAMAAANLANNQSNTKLMGVKQETSTSANNQTPGA
GAIGNNNLPIAAPLNTYQNMLRSSGASTISLQQEASSVFKGPTAMHNGMQLEAARSFLGP
NQVQFQHHPPSSSFQQQQQNSFHGFGVNPQYQQHVLNQLLQEVKNSNNRSKAQQPPLDAP
PPNASGGGLAPGVATPNVIAATGEQGQHVNNSSSNHNGTVKGAAGTGPSNVINNSTASMA
SARNSSFKSVSSSPAAAGNAVSSKVDDSFHQLEDLDDMIANELVESGLFGAGHGW*

MNGTHPWTSMSGGACSNLGYARDMNGNVPISTTNSSGPSIGVSSLVTDANSSLSGGAQLQ
PSTSMNGDSLMRVPASPMSFSSNNISGSSVIDGSIMQQSPPQEQMQKRRSSSVTSQHVID
AGGALHAQKKSRTDVSQGDIMQHQLIQHLIHGQNSLHFQGQQNPQLQAFIQQHKLAQLQQ
RQQQHLLQPFSQMQQPQVGIPRQPQLRPPLAQTGMQLGGPVRTPIERGVCSRRILQYLFH
KRHRPENNSITYWRKIVEEYFAPRARERWCVSSYENRGNSSAAAPQKALDTWRCGICNTH
AGKGYEATYEILPRLCQIRFDHGVIDEYLYFDSPNEFGLPNGQMVLEHAKVVQKSVYEHL
HVIHEGHLRIIFTPELKIISWEFCSRRHEEYTTRKTIAPQVNNLLQVVQKYQAVVTESGS
AGISNNDAQTICNMFVTASQQLAKNLEHHTLNEHGLSKRYVRSLQISEVVNHMKDLIEFS
HKNGLGPKESLNSYSKTMAKFQNMHDSRQLMAAANLANNQSNTKLMGTKEEASASATNQT
PGVGAIGNNALQHATPLNSYQNMLRSSSANPVLLQQEASSVFKGPTAMHSGIQLEAARSF
RGPNQVQFQHPAAIQQQQPMPQQSNFQGFGGVNPQYQHHVLNQLLQEVKNNNHVKAQQLP
PDAPKASGGLAPGVAIPNVAAAGEQGQHINSNTRDHNGAVKGAAPAGTGPSNVINNTASM
PPGRNNSFKSVSSSPAAATGGIAVNSKVDDSFHQLEDLDLDGLITNELMESGLFGAGQGW
*

Other information
Ka divergence:0.0525881KaKs divergence:0.303164
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):2328Length 2 (bp):2343Length divergence:0.003
MFE 1 (kcal):-777.26MFE 2 (kcal):-769.63MFE divergence-0.005