Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071573-GRMZM2G162531
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.2706215150157
Log2 mRNA fold difference:-0.41613581065244
Log2 TE fold difference:-0.98254418427238
Sequences
Protein sequence

MKPRTATLAAGLLQLVALAAVAEADTDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGA
AWTGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTY
LNLAKNNFSGNLPYSISNLVSLEYLNLSHNSLFQEIGELFGSLSSLSELDISFNNLTGNL
PFSMGSLSKLSSLYMQNNQLSGTVDVISNISLATLDIASNNFSGMIPQEFSSIPNLIVAG
NSFVNMPASPPQALTPPPNPRGRPDDRRGPTSAPTVPETPIDPDDKKMQTGPLVGIAVGS
IAAASCVLFALVLCLHNARKKPDDGSSEAKGIAGSHLVVTTSSREVMDSSHDNAAVATSD
LQLIQPAGKMTPDDRAHGPNGCTAKRPKQQVTVTTVSSYTVAALQVATNSFCQDSLLGEG
SLGRVYKAVFPNGKVLAVKKIDSASLSLYEEDNFLAVVSNVSRLRHPNIVPLAGYCVEHG
QRLLAYEYVGNGTLHDMLHFSDDDGMTMPGKTTRLAWNTRARIALGTARALEYLHEVCLP
PVVHRAFKSSNILLDDEYSPRLSDCGLAALSPNPETEREAFAGVVGSFGYSAPEFAMSGT
YTAKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDLLAKMVDPALDGL
YPAKSLSRFADIIAICVQSEPEFRPPMSEVVQQLVRLMQRASIVRRQSDDQLGYSYRVPE
RDGGDQSWRTLLLLHKALHSLYI

MKSRTATLAVGILLLVALVVVAEADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGA
AWAGVSCSGSAVTSIKLSGMELNGTLGYQLSSLQALKTIEYRNLAKNNFSGNLPYSISNL
VSLEYLDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGTVDVLSNISLATLNIADNNFS
GMIPQEFSSIPNLIVGGNSFVNMPASPPSTLKPPLEEPQGPVSAPTSPDTPIDQDDRKIQ
TGPLIGIAVGSIAAASCVLFVLVFCLHNARRRNDDEISEPKDLVGSLAVSIETAASSREV
LNNNHENSAVATSDLQHAGKMMMTPDRVLHDTTNGSSTAKRPKVPVTVTSYTVADLQVAT
NSFCEDSLLGEGSLGRVYKAGFPNGKVLAVKKVDDSALLSLYGGGEDAFLELVSNVSRLR
HPNIVPLTGYCVEHGQRLLVYEYVGNGTLRDVLQHCLSDDEGASKKLTWNTRVRIALGTA
RALEYLHEVCIPPVVHSRTFKASNILLDEEYSPHLSDCGLAALTTVVSPEAVGSFGYSAP
ELAMSGTYTAKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWAAPQLHDIDLLARMV
DPALDGLYPSKSLSRFADIIAICVQPEPEFRPPMSEVVQQLRAVQEMVEDPLGCWHARRP
QLLMDLEPGTMDSVRSGPFGQIFCPDNFVFQSGAGNNWAKGHYTEGAGNNRNRTRHPRPS
TTYLHPLSASDVGAPTGNRQVSLWGSSTKEITRDTLLQKVSEENQLHRHLCRAAAAALSI
QVIFTNDCYVFALCPFAGPQFQMNLKDEETTVETDSTQAPISQVLYTFHSVHHSMPKLEY
SSSKMDMEKEIRKQVDDAIAKAKLDEASRALLMKVLEDATQDVVQRQAKLNARALQRGYI
IPVYYDNLSTDESSPAELIGDWSCAEMLVLFETPARFTLFKVLDKVEVSDPRCNF*

Other information
Ka divergence:0.133279KaKs divergence:0.27828
GC content 1 (%):57GC content 2 (%):54GC content divergence:-0.027
Length 1 (bp):2229Length 2 (bp):2868Length divergence:0.125
MFE 1 (kcal):-863.81MFE 2 (kcal):-1021.49MFE divergence0.084