Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071602-GRMZM2G099238
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272915
Function (paralog2):protein binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.4451976500775
Log2 mRNA fold difference:-1.2813243611987
Log2 TE fold difference:-0.10342202341586
Sequences
Protein sequence

MATVGQSGALRRVTVHYASSPTRGAVVEVSLDDLDDELLQFVLADLLPGQEGLHQSILEG
AHGSNQENYMRGAGSSAPSQEYHAQSSTAAAAAAASSRRNPGTDDAQIASDFEYATKLQQ
EMEGLSVDDDGDGISCVPSPSDSDDGHDHQNEEDEEEEDGNGGGDDDDDPDNMTYEQRQA
LVESVGSEDRGLSDELISYLQPWKYKASGFFSRKTNHDDCPICLSTFRNRETMITLPCMH
HYHAACVTKWLRVNKTCPVCKYELFGPC*

MRQPPTLPISKAYIPPTNLELREERGDSKRHNTEVTGSRLSRWPWAIMATVGQSGALRRV
TVHYANSPTGSTVAEVSFDDLDDELLLFVLADLLPGQEGLHQSILEGTYNNQENHMRGAA
PSAPYGYSRPEEYRAESSTAAAAATGSRNSGMDEQIASDFEYAKQLQQEMEDLSVKDEDD
NDISCVPSPSDSDDEHEHHDEEEEADRQEDGDGDDDPDNMTYEQGQALVESVGTEYRGLS
DELISYLQPWKYKAVKASGLFSRKTNHEDCPICLSTFRNRETMITLPCRHHYHAACVTRW
LKVNKTCPVCKYELFGPS*

www.000webhost.com

Other information
Ka divergence:-0.0649715KaKs divergence:0.246174
GC content 1 (%):57GC content 2 (%):54GC content divergence:-0.027
Length 1 (bp):807Length 2 (bp):957Length divergence:0.085
MFE 1 (kcal):-306.8MFE 2 (kcal):-347.5MFE divergence0.062