Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071626-GRMZM2G145996
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277150
Function (paralog2):hypothetical protein LOC100279588

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0884011006848
Log2 mRNA fold difference:-0.99597566802138
Log2 TE fold difference:-0.13174258777805
Sequences
Protein sequence

MIPQSQSSSLQRLQHVEKRIVRVLELAGAVMEELGNSHGPRTDAVSAHCREFMIAMKEIQ
TTLREEIKSACEYRPFEKCDYSARIANEICCKKLEYVIEKLDTMQQSLEHITDDV*

MIPQSQSSSLQRLQHVEKRIVRVLELAGAVMEELGYSQGPRTDAVGAHCREFMMAMKEIQ
TTLREEIKSACEYRPFEKCDYSARIANEICCKKLEYVLEKLDTMQQNLEQSTDNV*

Other information
Ka divergence:-0.0277778KaKs divergence:-0.271671
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):348Length 2 (bp):348Length divergence:0
MFE 1 (kcal):-112.3MFE 2 (kcal):-111.3MFE divergence-0.004