Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071790-GRMZM2G172932
Species:maize
Duplication type:WGD
Function (paralog1):Tubulin beta-6 chain (Beta-6-tubulin)
Function (paralog2):hypothetical protein LOC100382290

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.96524860666676
Log2 mRNA fold difference:-1.7644114140042
Log2 TE fold difference:0.79107886704371
Sequences
Protein sequence

MLAAATAAYGYFNPALLPTPHSPPASSRLPDLARSAPVASQFGSSHTSAKMREILHIQGG
QCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFVPRAVLMDLEP
GTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCL
QGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVH
QLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDL
RKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRY
LTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGN
STSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
DEEEYEDEEEVQADDM*

MREILHIQGGQCGNQIGAKFWEVVCDEHGIDTTGRYTGTSDLQLERVNVYYNEASCGRFV
PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRG
LSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADDDEEAEYEDEEEPADGIIPPSWPIPSIVAVDACVSLFYRTLLLVR

Other information
Ka divergence:1KaKs divergence:0.996825
GC content 1 (%):57GC content 2 (%):55GC content divergence:-0.018
Length 1 (bp):1491Length 2 (bp):1428Length divergence:-0.022
MFE 1 (kcal):-568.01MFE 2 (kcal):-526.02MFE divergence-0.038