Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071907-GRMZM2G091331
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273049
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.5038809085796
Log2 mRNA fold difference:0.32225497763229
Log2 TE fold difference:0.21628560600015
Sequences
Protein sequence

MAVDLMGCYAPRRANDQLAIQEAAAAGLRNLELLVTSLSTQAAAPHRAADQPFGEIAGQA
VSKFRKVISILDRTGHARFRRGPVEPPPPTPPPPPVVPGPAPLAAVSVAQPPQSLTLDFT
KPNLAVSAATSVTSTSFFSSVTAGEGSVSKGRSLMSSGKPPLSGHKRKPCAGAHSEATTN
GSRCHCSKRRKNRVKRTIRVPAISSKVADIPSDEYSWRKYGQKPIKGSPYPRGYYKCSTV
RGCPARKHVERATDDPAMLVVTYEGEHRHTPGAVQGPSPLATASPVPVAVSAGNGLVV*

MAVDLMGCYAPRRANDQLAIQEAAAAGLRSLELLVSSLSTQAAAPHRAAAHQLQKPPSQP
PIGEIADQAVSRFRKVISILDRTGHARFRRGPVVEAPPPVPPPAVSAPALPVAHVVAPVG
AAQPQSLTLDFTKPNLAVSGGATSVTSTSFFSSVTAGEGSVSKGRSLVSSGKPPLSGHKR
KPCAGAHSEATTNGSRCHCSKRRKNRVKRTIRVPAISAKIADIPPDEYSWRKYGQKPIKG
SPYPRGYYKCSTVRGCPARKHVERATDDPAMLVVTYEGEHRHTPGAPAPAPSPLAAASPV
PASAAAAVSAGNNGLV*

Other information
Ka divergence:0.360674KaKs divergence:0.0940767
GC content 1 (%):71GC content 2 (%):73GC content divergence:0.014
Length 1 (bp):897Length 2 (bp):951Length divergence:0.029
MFE 1 (kcal):-440.31MFE 2 (kcal):-490.7MFE divergence0.054