Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071959-GRMZM2G057852
Species:maize
Duplication type:WGD
Function (paralog1):Histone H2B.1
Function (paralog2):Histone H2B.3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAPKAEKKPAAKKPAEEEPATEKVEKAPAGKKPKAEKRLPAGKSKEGGEGKKGKKKAKKS
VETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAESAKLARYNKKPTITSRE
IQTSVRLVLPGELAKHAVSEGTKAVTKFTSS*

MAPKADKKPAAKKPAEEPATEKAEKAPAGKKPKAEKRLPAGKSAGKEGGEGKKGKKKAKK
SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAESAKLARYNKKPTVTSR
EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):62GC content divergence:0
Length 1 (bp):456Length 2 (bp):459Length divergence:0.003
MFE 1 (kcal):-175.5MFE 2 (kcal):-174.8MFE divergence-0.002