Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G071977-GRMZM2G065829
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381732
Function (paralog2):hypothetical protein LOC100194332 (LOC100194332), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MARKCSHCGNCGHNSRTCGRETMLCEAGDNGGHGGLRLFGVQVRIGGGGAGSASMKKSYS
MDCLQLAAPGCSLVSPSTSSSSSSLLLMSIEEGSERGAPNGYLSDGPHGRAVQERKKGVP
WSEEEHRQFLSGLEKLGKGDWRGISRSYVPTRTPTQVASHAQKFFLRQSSLGKKKRRSSL
FDMVPICENSASISDPLSSEGASTSLSLNVPRHGVTSVSERAALDLNSTEEDDSRADASS
ASASGAGTRPPFPAAQTEPLQPSSLGRGRGHHCSPLDLELAMSLPAPSIGT*

MARKCSHCGNYGHNSRTCGLGLGLGHREIMLCEGGDDNNGRSGLRLFGVQVRIGGGGGAG
SASMKKSYSMDCLQLAAPHACSSLVSSPSSSSLCSSSSPSSLLLSIDDGLQRGAADGYLS
DGPHGRAVQERKKGVPWSEEEHRQFLAGLDKLGKGDWRGIARSYVPTRTPTQVASHAQKF
FLRQSSMGKKKRRSSLFDMVPICENSASISDPLDVARHGVASADSERAAVDVDLMNSTTE
GDDGRSRDVVSSASGAGTALRFPAAAAQTEPLHPSSSHGHGRGHHCSPLDLELGMSLPAP
SVGT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):63GC content 2 (%):64GC content divergence:0.008
Length 1 (bp):876Length 2 (bp):915Length divergence:0.022
MFE 1 (kcal):-401.3MFE 2 (kcal):-430.6MFE divergence0.035