Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G072205-GRMZM2G124335
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280304
Function (paralog2):hypothetical protein LOC100193451

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.0262389616993
Log2 mRNA fold difference:0.9695629674706
Log2 TE fold difference:-0.0065619077286918
Sequences
Protein sequence

MAAVAGPLCTWLVAACLSAACDAEEHKQKHFCAGGSRAGGGVMLGQRRRLGARRRGLARS
GMTMAVALQAERSVIEKKKPDIKQRRVVVTGMGVVTPLGHDPDVFYNNLLDGVSGISEIE
RFDCSNFPTRIAGEIKSFSTDGWVAPKLAKRMDKFMLYLITAGKKALENGGLTEELRNEL
DKTRCGVLIGSAMGGMKVFNDAIEALRVSYKKMNPFCVPFATTNMGSAILAMDLGWMGPN
YSISTACATSNFCILNAANHIRRGEADVMLCGGSDAPLIPIGLGGFVACRALSQRNSDPT
KASRPWDMGRDGFVMGEGAGVLVLEELEHAKERGATIYAEFLGGSFTCDAYHMTEPHPEG
RGITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSM
TGHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVGVLVGSQKERCEVKVALSNS
FGFGGHNSSILFAPFK*

MAAVAGPLCTWLVAACLSAACDAEEYKQKHCCPGGSGAGGGVMLGLRRRLGARRRGLARS
GMAMAVALQAERSVIEKKKPDIKQRRVVVTGMGVVTPLGHDPDVFYNNLLDGVSGISEIE
RFDCSNFPTRIAGEIKSFSTDGWVVPKLAKRMDKFMLYLITAGKKALENGGLTEELRNEL
DKTRCGVLIGSAMGGMKVFNDAIEALRVSYKKMNPFCVPFATTNMGSAILAMDLGWMGPN
YSISTACATSNFCILNAANHIRRGEADVMLCGGSDAPLIPIGLGGFVACRALSQRNSDPT
KASRPWDMGRDGFVMGEGAGVLVLEELEHAKERGATIYAEFLGGSFTCDAYHMTEPHPEG
RGITLCIEKALADAGVAREEINYVNAHATSTQAGDLKEYEAIVRCFRQNPQLRVNSTKSM
TGHLIGAAGGIEAVASIQAIRTGWVHPNLNLENPEDTVDVGILVGSQKERCEVKVALSNS
FGFGGHNSSILFAPFKELPSSSSSK*

Other information
Ka divergence:-0.00308452KaKs divergence:-0.2
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1491Length 2 (bp):1518Length divergence:0.009
MFE 1 (kcal):-550.7MFE 2 (kcal):-551.57MFE divergence0.001