Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G072264-GRMZM2G114325
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193735
Function (paralog2):RNA recognition motif containing protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.73940984532012
Log2 mRNA fold difference:-3.2344103808847
Log2 TE fold difference:2.6161138661284
Sequences
Protein sequence

MTSRIMSETGHTVQVTNLSSRVSESDLHEFFSFSGPIEHIELIRSEGYGATAYVTFKERF
ALETAVLLSGATIVDQPVCITYWGQPEGTFNFWDRPTWEVEEEIEYRNYQTCQYNTTPQE
AFTVAQDIMKTMLEKGYVLSKDALAKARAFDESYGLTAAAAARAAELSKRIGLTDRVNAG
VGAMRSVDETYRVRETTKTVATATGRTAAKVVNGIVTSSYFSAGAMILSDALTRAAKAAA
DLAAHGRQN*

MSETGHTVQVTNLSSRVSESDLYEFFSFSGPIEHVELIRSGEYGATAYVTFKERFALETA
VLLSGATIVDQPVCITYWGQPEETFNFWDRPTWEVEEEIEYTSYQSCQYNTTPQEALTVA
QDIVKTMLAKGYVLSKDALAKARAFDESRGLTAAAAAKAAELSKRIGLTDRVSAGVGAMR
SVDETYRVTETTKTVATATGRTAAKVVNGIVTSSYFSAGAMMLSDALTRAAKAAADLAAH
GRQS*

Other information
Ka divergence:-0.398388KaKs divergence:-0.74596
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):750Length 2 (bp):735Length divergence:-0.01
MFE 1 (kcal):-249.2MFE 2 (kcal):-257.86MFE divergence0.017