Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G072500-GRMZM2G113370
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100194378

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.7833489736245
Log2 mRNA fold difference:1.6786066919501
Log2 TE fold difference:0.13441754455367
Sequences
Protein sequence

MATELDVSKSRRFDIAMSRRTRRSTSLVACFQDQYTPSLAQHRHQELKAFLQCQDEELKA
LQRCEDAEHKTLCLNEDEELKIPQVPMQYEDDKQETPEQYEDGQEKESQQYPDQEQEIPD
SCQDDEKTPNQYLDEGKMLEQYQDEDDELPSQYQDHELVTQKLPEEDEGTASERFQDEER
KELHQHQEADEQTSQSEDEEEPKSQQERHDVEQKAPKQFQVLKKVAAPPRPVENVPRFSL
QELIRQKQQLPTGEAMATSKVGGRGESVLADHMVSGAGAAAAEGTALAMVIKRPEGGKKP
MGMIRRCVKALNQMIKAKHGSKKNLHF*

MATELDVSKSRRFDIAMSRRTRRSTSLVACFQDQYTPSLAHHRHQELKAFLQRQDEELKS
LQQCQEEELKALQQCEDAEQKTLCLNEDEDLKIPQAPLQYEDGEQKTPEQYEDEHKESQQ
CSDEEQEIPDTYQDDEKKPDQDQYLNEDKMPEQYRAKDELPSQYQNQELMTPNLPEKETA
SERFQEAEQLVTPNLPEEDEETAPKQFQDEEQKGLQQHQEPDEQASQPEEQKSQQECHQK
APEQFQTLKKLGAPPRLADNVPRFSLQELIQQKQLPTGDAMLASKQGSRGESVLADHSVS
GPGAAAGGTTLAMVIKRPEGGKKSMGVIRRCVKALNGMIKAKHGSKKNLHF*

Other information
Ka divergence:-0.121947KaKs divergence:-0.0608261
GC content 1 (%):54GC content 2 (%):51GC content divergence:-0.029
Length 1 (bp):984Length 2 (bp):1056Length divergence:0.035
MFE 1 (kcal):-338.3MFE 2 (kcal):-326.51MFE divergence-0.018