Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G072653-GRMZM2G376661
Species:maize
Duplication type:TD
Function (paralog1):Cytochrome P450 CYP74A18
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.6773794137677
Log2 mRNA fold difference:0.7076773655437
Log2 TE fold difference:-0.33487636662516
Sequences
Protein sequence

MATATYLSSSFSSPPPPSSRARLRRQTTRAGASAATDRPREVLSPKRRLPLREVPGDYGP
PVLGAVRDRFEYFYGPGGRDGFFASRVRAHGSTVVRLNMPPGPFVARDPRVVALLDAASF
PVLFDTSLVDKTDLFTGTFMPSTDLTGGYRMLSYIDPAEPSHGPLKALLFYLLSHRRQHV
IPKFREVYGDLFGVVENELARVGKADFGHHNDAAAFSFLCQALLGRDPAESALHGDGPKL
ITKWVLFQLSPLLSLGLPKHLEDSLLHSFRLPPALVRKDYGRLADFFRDAARTVVDEGER
LGIAREEAVHNILFATCFNSFGGMKILFPSLVKWLGRAGARAHGRLATEVRDAVRAHAGE
VTMKALAEMPLVESAVYEALRIEPPVAMQYGRAKRDMVVESHDYGFEVREGEMLFGYQPM
ATKDPRVFARAEEYVPDRFLGEDGAQLLRHVVWSNGPETASPTLQDKQCAGKDFVVLIAR
LLVAELFLRYDSFDVQVGASALGSSVTITSLKKATF*

MATATYLPSSFSFSSPPPPPSSRARLRRQTTRAGASAATDRPREVLSPKRRLPLREVPGD
YGPPVLGAVRDRFEYFYGPGGRDGFFASRVRAHGSTVVRLNMPPGPFVARDPRVVALLDA
ASFPVLFDTSLVDKTDLFTGTFMPSTDLTGGYRVLSYLDPAEPSHGPLKALLFYLLSHRR
QHVIPKFREVYGDLFGVVENELARVGKADFGHHNDAAAFSFLCQALLGRDPAESALQGDG
PKLITKWVLFQLSPLLSLGLPKHLEDSLLHSFRLPPALVRKDYGRLADFFRDAARSVVDE
GERLGIAREEAVHNILFATCFNSFGGMKILFPSLVKWLGRAGARAHGRLATEVRDAVRAH
AGEVTMKALAEMPLVESAVYEALRIEPPVAMQYGRAKRDMVVESHDYGFEVREGEMLFGY
QPMATKDPRVFARAEEYVPDRFLGEDGAQLLRHVVWSNGPETASPTLQDKQCAGKDFVVL
IARLLVAELFLRYDSFDVQVGASALGSSVTITSLKKATF*

Other information
Ka divergence:-0.679934KaKs divergence:0.999617
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1551Length 2 (bp):1560Length divergence:0.003
MFE 1 (kcal):-793.51MFE 2 (kcal):-808.11MFE divergence0.009