Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G072855-GRMZM2G073275
Species:maize
Duplication type:TD
Function (paralog1):Histone H4
Function (paralog2):Histone H4

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.19172962998436
Log2 mRNA fold difference:0.19209479982366
Log2 TE fold difference:-0.38016791140497
Sequences
Protein sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
IFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG*

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
IFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):67GC content 2 (%):65GC content divergence:-0.015
Length 1 (bp):312Length 2 (bp):312Length divergence:0
MFE 1 (kcal):-137.44MFE 2 (kcal):-136.4MFE divergence-0.004