Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G072865-GRMZM2G163193
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100273697

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.1823859443428
Log2 mRNA fold difference:-0.070197208798253
Log2 TE fold difference:0.25316400563307
Sequences
Protein sequence

MASAAAETLASFPIASPSRSLLRPFPRRPAGARTGAPSIRISAVPPRGLGLALVHRRCPP
AARANVERDGDGASGNGEPSSSSGDGDRDAAAESGGDSTSTSTTSTAATPPPPSSKRNEN
KWRRRLTKGGGVGRWLWEPIVQGREMGFLLLQLGFAIFALRMLRPEIALPGSEPRPQTTY
VSVPYSDFLASINKDQVKKVEVDGVHIMFRLRPEVESQVRVEQTPTQRGADYVIDNAGVS
RRIVFTTTRPVDIKTPYEKMVENMVEFGSPDKRSGGMLNSALVGLIYVVLIAVVLQRLPI
SFSQQSPGQLRNRKNSNSGGAKVSESSDIVTFADVAGVDEAKEELEEIVEFLRNPERYIR
LGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGAARVRDLFAK
AKKESPSIIFIDEIDAVAKSRDSRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGATN
RADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVKRRELPLSKDVDLANIAAMTTGF
TGADLANLVNEAALLAGRLNKEIVEKVDFIRAVERSIAGIEKKHAKLKGNEKAVVARHEV
GHALVGTAVANLLPGQPRVEKLSILPRSGGALGFTYTPPVTEDRYLLFVDELRGRLVTLL
GGRAAEEVVLAGRVSTGALDDIRRATDMAYKAVAEYGLSQRIGPISLATLSNGGLDDSGG
SPWGKDQGHLVDLVQREVKALLQSSLEVALSVIRANPAVLEGLGAYLEEKEKVEGEELQE
WLKSVVASKELTSFIRGQQEQVLQLEAGS*

MASAAVETLVSFPIASRPRSLLRPFPRRPAAAAAAGGCAPSIRISAVPPRGLGLALVHRR
ARRCPPAARANVEHGGDGASGNGEPSSSSGDGDRDAAADSGGDTTGTSTTSAAQTPPPPS
SKRGENKWRRRLTKGGGVGRWLWEPIVQGREMGFLLLQLGFAVFALRMLRPEIALPGSEP
RPQTTYVSVPYSDFLASIDKDQVKKVEVDGVHVMFRLRPEVESQVRVEQTPSQRGTDAVV
DNAGVSRRIVFTTTRPVDIKTPYEKMVENMVEFGSPDKRSGGTLNSALVALIYVVLIAVV
LQRLPISFSQHSAGQLRNRKNSNSGRAKVSESTDIVTFADVAGVDEAKEELEEIVEFLRN
PERYVRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGAARV
RDLFAKAKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVI
VLGATNRADVLDPALRRPGRFDRVVMVEAPDRFGRESILKVHVSRRELPLSKDVDLADIA
AMTTGFTGADLANLVNEAALLAGRLNKEIVEKIDFIHAVERSIAGIEKKHAKLKGNEKAV
VARHEVGHALVGTAVANLLPGQPRVEKLSILPRSGGALGFTYTPPTTEDRYLLFVDELRG
RLVTLLGGRAAEEVVLAGRVSTGALDDIRRATDMAYKAVAEYGLNQRIGPISLATLSNGG
LDDSGGSPWGRDQGHLVDLVQREVKALLQTALEVALSVIRANPAVLEGLGAYLEENEKVE
GEELEEWLKSVVASKELTSFIRGQQEQVLQLEAGS*

Other information
Ka divergence:0.0228867KaKs divergence:-0.000675828
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):2430Length 2 (bp):2448Length divergence:0.004
MFE 1 (kcal):-921.8MFE 2 (kcal):-940.15MFE divergence0.01