Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G072890-GRMZM2G099003
Species:maize
Duplication type:TD
Function (paralog1):late embryogenesis abundant protein
Function (paralog2):hypothetical protein LOC100216641 (LOC100216641), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-3.0122757866527
Log2 mRNA fold difference:-3.6608120611933
Log2 TE fold difference:0.68402008815918
Sequences
Protein sequence

MERVASSYCVSLLAQSRRAYTVAAAMAKKGAAARRVDEKKAAAALTKRVMGKKEVNTAAA
AAAEEKAWVPDPVTGYYRPAGSAKEVDAAELRAKLLTEAAAN*

MERAASSCASLLAQRRCYSVAAVVVKGCGRKAVEKVAKRIMGKEVNTAAASGEKTPWVPD
PVTGYYRPAGGAKEVDAAELRARLLTKRIAN*

Other information
Ka divergence:0.0300581KaKs divergence:0.774482
GC content 1 (%):65GC content 2 (%):67GC content divergence:0.015
Length 1 (bp):309Length 2 (bp):276Length divergence:-0.056
MFE 1 (kcal):-137.6MFE 2 (kcal):-125.9MFE divergence-0.044