Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G073079-GRMZM2G076348
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.43866457675016
Log2 mRNA fold difference:-0.27526466226665
Log2 TE fold difference:0.7009498294191
Sequences
Protein sequence

MPSSAQVLLCLAAVLAAAAATTAEAHSQCLDNPPDRSIHGRQLAEAGEVVHDLPGGLRAY
VSGAASSSRAVVLASDVFGYEAPLLRQIADKVAKAGYFVVVPDFLKGDYLDDKKNFTEWL
EAHSPVKAAEDAKPLFAALKKEGKSVAVGGYCWGGKLSVEVGKTSDVKAVCLSHPYSVTA
DDMKEVKWPIEILGAQNDTTTPPKEVYRFVHVLRERHEVPYYAKIFQGVEHGFACRYNTT
DPFAVKTAETALAYMVSWFNKHLN*

MPSSAQVLLCLAAVLAAAAATTAEAHSQCLDNPPDRSIHGRQLAEAGEVVHDLPGGLRAY
VSGAASSSRAVVLASDVFGYEAPLLRQIADKVAKAGYFVVVPDFLKGDYLDDKKNFTEWL
EAHSPVKAAEDAKPLFAALKKEGKSVAVGGYCWGGKLSVEVGKTSDVKAVCLSHPYSVTA
DDMKEVKWPIEILGAQNDTTTPPKEVYRFVHVLRERHEVPYYAKIFQGVEHGFACRYNTT
DPFAVKTAETALAYMVSWFNKHLN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):62GC content divergence:0
Length 1 (bp):795Length 2 (bp):795Length divergence:0
MFE 1 (kcal):-334.68MFE 2 (kcal):-336.78MFE divergence0.003