Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G073725-GRMZM2G087326
Species:maize
Duplication type:WGD
Function (paralog1):Alpha-1,4-glucan-protein synthase [UDP-forming] (EC 2.4.1.-)(UDP-glucose:protein transglucosylase)(UPTG)(Amylogenin)(Golgi-associated protein se-wap41)
Function (paralog2):hypothetical protein LOC100274298

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.54680000510804
Log2 mRNA fold difference:-1.3518389685018
Log2 TE fold difference:0.75577072112264
Sequences
Protein sequence

MAGTVTVPGSSTPSTPLLKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPTKTIK
VPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPS
GKDINALEQHIKNLLSPSTPFFFNTLYDPYREGADFVRGYPFSLREGAHTAVSHGLWLNI
PDYDAPTQLVKPKERNERYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAMYFGLMGDGQP
IGRYDDMWAGWCVKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEDIIPFF
QNVTIPKDCDTVQKCYIYLSGQVKEKLGTIDPYFVKLGDAMVTWIEAWDELNPSTPAAAN
GKAK*

MAGTVTVPGSSKPSTPLLKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPTKTIK
VPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPS
GKDINALEQHIKNLLSPSTPFFFNTLYDPYREGADFVRGYPFSLREGAHTAVSHGLWLNI
PDYDAPTQLVKPKERNERYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAMYFGLMGDGQP
IGRYDDMWAGWCVKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEDIIPFF
QNVTIPKDCDTVQKCYIYLSGQVKEKLGKIDPYFAKLGDAMVTWIEAWDELNPAGPAAGK
DKAK*

Other information
Ka divergence:0.271305KaKs divergence:0.235457
GC content 1 (%):57GC content 2 (%):57GC content divergence:0
Length 1 (bp):1095Length 2 (bp):1095Length divergence:0
MFE 1 (kcal):-401.82MFE 2 (kcal):-412.92MFE divergence0.014