Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G073755-GRMZM2G043338
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191792
Function (paralog2):hypothetical protein LOC100273280

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGLLDKLWDDTVAGPRPDTGLGRLRKQPVRPAAVKISDPAGDAAAFVPPSPASGSEETPV
KVTRSIMIKRPAGYPSSPRSAASTPPASPLGTTPPISPFAGAAVSRCFIDDLKSGILSLS
MVKRLPPFQSRVSELVS*

MGLLDKLWDDTVAGPRPDTGLGRLRKQPARPAAVKISDPAGDAAALVPPSPASGSEETPV
KVTRSIMIKRPAGYPSSPRSAASTPPASPLGTTPPISPFAGAEGNHHPTHMRGQPLQGRP
ATLLPSKCEPAAPSHLFCSLTSISSPIIR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):64GC content 2 (%):66GC content divergence:0.015
Length 1 (bp):414Length 2 (bp):450Length divergence:0.042
MFE 1 (kcal):-176.04MFE 2 (kcal):-184.79MFE divergence0.024