Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G073779-GRMZM2G073805
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100383117

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.1053334695059
Log2 mRNA fold difference:-1.3998159421048
Log2 TE fold difference:-0.50293514051068
Sequences
Protein sequence

MAAAPEAEGLFGDPEPFSPSIFLDLPPTPRPDGNDEVPASSDDLVLPFITRILMEEDIND
QFFYQFPDHPVLLRAQEPYAQILSEPATARAASGSPATVSPSSDEDPVQPLLSPPYPDTG
LRDINDDGVGASPGFEQSDPGKLRTAALGLPTGDGDRAALAPVFFNSGDADAEMLNKAFL
KGMEEAKKFLPTTSSSLLIYPPGAEEELGINGRGRKDRDRLGWDDLEAETFRKSKLMVPE
PEETDEMVDQMIFNGLEMCLREMKALRISMGSGEAKKNSRKGKQGRRSSADEAVELSTLL
VHCAQAVATDNRRSATELLRQIKQQSSPKGDATQRLAHCFAEGLEARLAGSGSQLYRSLM
AERIPAMEYLRAYWLYLAACCFKMTAFSFSNKTILKAIAGRRKVHIVDYGIDYGVQWPSL
LGRVATMDMEGGPPEVRITGIDLPQPGFRPAARIDETGRRLSDYARQIGVPFKFRGITAR
WDAVGADDLSIDPDEVLIVNSIVRFGNLMDEGADIDSPSARDVVLGAIREARPDAFILHV
MNVSYGAPFFVTRFREALFFYSAMFDMLDATAPRDSRQRFMVERGFFRQCALNVVACEGV
DRVERPETYRQWQARNRRAGLRQLPLDPDTVRALREKVREQYHRDFVIDTDRDWLLEGWK
GRILYAMSTWVADDDAVSEHHHTYTY*

MAAEPADVGDSEPEPFSPSDFLNLGPPTPRLDSPALQLHDDDDDLVLLFISRMLMEEETD
GFFEQYHPDHPALLQAQQPFADILAGAAAADGSRGTSVAGSPAFAANAIWPYDPVQLSQL
LLSRTYPADTAAYPSAAADSMASSAGSGAGTVNMDMLNLAFLKGMEEASKFLPATSNNHD
HRRQATETCDKRVDESSPLLQQSASKGRKNHRHAPYWGEDEEAETGRRSCKVMAVETEES
EMVEEFVQSGYDSLHEQMMAMTLSTAGSRKGKGKGKGSANEAVDLRTLLIHCAQAVAAGN
RPSAADLLGKIRARSSPRGDATQRLAHCFAGGLEARLAGTGTQQLTAATKRASAVEILRA
YQLYLAACSFTAMAYKFSNLAICKAVGGGGRKKVHIVDYGDHYYGFQWPSLLGYWGSLEA
GPPEVRITAIDFPEPGFRPDARLQATGRRLTCFARRHGVPLRFHGIEARWDAVSVDELSI
ERDEVLVVNGLFSLGRMQEQEQDDVDRDSRPSPRDTVLGNVRKMRPDVFVLCVENSSYGA
PLFVTRFREALFYYSALFDMMDAVAARDDDDRVLVEQHLFGQRALNAIACEGSDRVERPE
TYRQWQVRNERAGLRQLPLDPDAVRAIRRKVKDKYHRDLFIDEDQQWLLQGWKGRVLYAM
SAWAAK*

Other information
Ka divergence:0.310446KaKs divergence:0.151481
GC content 1 (%):63GC content 2 (%):66GC content divergence:0.023
Length 1 (bp):2061Length 2 (bp):2001Length divergence:-0.015
MFE 1 (kcal):-921.92MFE 2 (kcal):-948.81MFE divergence0.014