Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G073861-GRMZM2G150950
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100216700
Function (paralog2):AT hook motif family protein (LOC100283634), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7472273761091
Log2 mRNA fold difference:-0.22745786318526
Log2 TE fold difference:-1.6198251367191
Sequences
Protein sequence

MASEGNKDVPHEALTVDHSSISGSKRKRGRPRKYEYPVNELPQKVQPIQSAPPLLHCTQD
GSSLASHASGGGAHGNWSAQPRNSANASLQGNSGKDDFLGKHFVGKLTKKVPGFSLITVK
VKDNQVLKGWVPDEINLRPITPKDDLAPELPMLRPSQVRKRASAIHMQPALPVPMHLENV
TLAKPLQMRRPVEKTIAKHAVPLASRPYISSGVVAAIPISVAPINPEMRTSARQDAELVI
PQSSVSAVPIKFVCPASVPCKQLANQNEFTGNKSVDEVQKDSESPNVTKESPVKAEKPNI
ALVDVVAKDSLGEGQQLNDQVTDVVRDFSGQTQNVDVTMSDEIKIASGARDKPNSANCEQ
QSSKEPSDITEQSEQLKTETDVQKGVDASDDIHPAHDEQ*

MSSEGNKDVPNEALSVDLSSISGAKRKRGRPRKYEHPAYELPQKVQPLQSAPPLHCSQDG
SSMASHTSGGYAHGSWSAQPRNSVNASIQGNSGKDDVLGKHFVGKLTKKIPGFSLITVKV
KDNQVLKGWVPDEINLRPITPKDDLAPELPMLRPSHVRKRASAIHMQTALTVPLHLEDIT
LAKPLQMRRPVEETIAKHSVPLAPRPYMGSGVVAPVPISVALAPNNPELTSLTRQDAELV
IPQSSVAAVPITSVPPCKQLANQNEFTEKNYVDEFQKDSESRNVTKELPGERQQLNDQVT
DVVTESSGQIQNTDATVSDKIKITSGARDQPNPANSEQHEQQSSKEPSDITEQYEQMKTE
TDVQKGVDASKSDASVPDDIQPACDEQEIKVGCK*

Other information
Ka divergence:0.224859KaKs divergence:0.45368
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1200Length 2 (bp):1185Length divergence:-0.006
MFE 1 (kcal):-364.92MFE 2 (kcal):-362.81MFE divergence-0.003