Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074097-GRMZM2G018375
Species:maize
Duplication type:WGD
Function (paralog1):Thiazole biosynthetic enzyme 1-2, chloroplastic Precursor
Function (paralog2):Thiazole biosynthetic enzyme 1-1, chloroplastic Precursor

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATTAASSLLKSSFAGSRLPSATRTTTPSSVAVATPRAGGGPIRASISSSPTPPYDLTSF
RFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPTVSVAIVEQS
VSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKHAALFTSTVMSRLLAR
PNVKLFNAVAVEDLIVRRGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP
FGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRM
GPTFGAMMISGQKAAHLALKALGRPNAVDGTIPEVSPALREEFVIASKDDEVVDA*

MATAAASSLLKSSFAGSRLPAATRTTPASLVVATGPRGAGAGPICASMSMSSSNPPYDLT
SFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPAVSIAIVE
QSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTSTVMSLLL
ARPNVKLFNAVAVEDLIVRGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHD
GPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAP
RMVSSEEDNTHVIAILTESMRNMSKIVCWLLQGPTFGAMMISGQKAAHLALKALGRPNAV
DGTMSPPLREELMIAYKDDEVVDA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):66GC content divergence:-0.029
Length 1 (bp):1068Length 2 (bp):1155Length divergence:0.039
MFE 1 (kcal):-555.6MFE 2 (kcal):-556.8MFE divergence0.001