Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074138-GRMZM2G113866
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194211
Function (paralog2):sigma factor sigB regulation protein rsbQ

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0499027153693
Log2 mRNA fold difference:-2.1254755070324
Log2 TE fold difference:1.0761910280406
Sequences
Protein sequence

MGIVEEAHNLRVVGEGKRGVIVLAHGFGTDQSVWKHLVPHLVADYRVVLFDTMGAGPTNP
DYFDFSRYATLEGYALDLLAILQELGVRSCIYVGHSVSAVIGALASISRPDLFTKLVLLS
ASPRYLNDVDYYGGFEQDELDELFEAMRSNYKAWCSGFAPLCVGGDMESVAVQEFSRTLF
NIRPDIALSVAQTIFQSDVRSLLPHVTVPCHIVQSTKDLAVPVVVSEYLHRHLGGDSIVE
VMPSEGHLPQLSSPDIVIPVLLRHIQHDIAV*

MGIVEEAHNLRVVGEGKRGVIVLAHGFGTDQSVWKHLVPHLVADYRVVLFDTMGAGPTNP
DYFDFSRYSTLEGYALDLLAILQELGVQSCIYVGHSVSAIIGALASISRPDLFTKLVLLS
ASPRYLNDVDYYGGFEQDELDELFEAMQSNYKAWCLGFAPLCVGGDMESVAVQEFSRTLF
NIRPDIALNVAQTIFQSDVRSLLPHVSVPCHIVQSTKDLAVPVVVSEYLHRHLGGDSIVE
VMPSEGHLPQLSSPDIVTPVLLRHIQHDIAV*

Other information
Ka divergence:0.504544KaKs divergence:0.661616
GC content 1 (%):61GC content 2 (%):59GC content divergence:-0.017
Length 1 (bp):816Length 2 (bp):816Length divergence:0
MFE 1 (kcal):-330.6MFE 2 (kcal):-304.65MFE divergence-0.041