Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074193-GRMZM2G045192
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278337
Function (paralog2):hypothetical protein LOC100194152

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEGCAKFMASDTGKKLIQIDVSSDTVCPWCFVGKKNLEKAMEQSMGKFDFEVRWHPFFLN
PDAPKEGVKKSDFFKMKFGPVQYEGAMSRMTEIFRGLGLEYDMSGLTGNTMDSHRLITHA
GHQGYDKQNALVEELFLNYHCQGKYIGDKQVLLDAARKVGIEGAEELLEDPTKGVHEVQE
ELKKYSSDISGVPHFVINNKYQLSGGQPPNEFMRAFEMAAKDGA*

MPGRLLSVRIPSLAKLGAPRCAKSMASDTGKKLIQIDVSSDTVCPWCFVGKKNLEKAMEQ
SRDKFDFEVRWHPFFLNPDAPKEGVRKSDFYKAKFGPVQYERVISRMAEIFRGLGLEYDM
SGLTGDTMDSHRLIALAGHQGYDKQNALVGELFLNYFCEGKYIGDKQVLLDAARKVGIEG
AEELFQDPTKGVDEVQEELKKYSSGISGVPHFVINDKYQLSGGQPPNVFMRAFEMAAKDG
A*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):675Length 2 (bp):726Length divergence:0.036
MFE 1 (kcal):-209.7MFE 2 (kcal):-240.1MFE divergence0.068