Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074245-GRMZM2G102681
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277288
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.054479463824083
Log2 mRNA fold difference:-0.23983738897199
Log2 TE fold difference:0.32574083419233
Sequences
Protein sequence

MAAMGWSDLPSELLTDIAGRINELADIARFRSVCSSWRSAARDAVAAPPPQPPWLLLPSS
PSRLFFCPREDRIYPNLRLPHPAAEVHHRRPRPHLYASPHGWALAIDPTDLAASLVHPFT
GATRPLPPLPFFFAETEDLAWDWSPHGVMASSGEGLLFCAADPTTAASWSPIRALYDCNA
SSINYAGGKFFVFEEDVCRTTIVDAVTLAIAAVIPAPAVELPAEARVAVAGDELFLLVKS
KWMYLFSDDVDFSKAFHVNHRSVNSAWQELTGIGERALFVDSHHGFAVPTAGFGNLESNT
IYSVSSKKVNYSVSAFSLETRTSKKLACRLNDQEMAMRGEMPSWIVPRLDEV*

MAATGWSDLPSELLTDIAGGITELADIARFRSVCSSWRSAARDAAAAPPPQPPWLLLPSS
PSWLFFCPREDRIYPNLRLPRPAAEAHHRRRRRLYASPHGWALAIDPTDLAASLVHPFTG
ATRQLPRLPSFFAETDDMAWDWSPHGVMASCGEGLLFCGADPTAAASSWAPIPALADCNA
SSINYAGGEFFVFEEDVCRTTVVDAVTLAVAAVIPAPAVELPAEARVAVAGDELFLLVKS
KWMYLFGDDVDFSKAFHVNHRGVNPPAWQELAGIGDRALFVDSLHGFAVPTAGFGNLENN
TIYSVSSKEVNNRRPTTVNYNVSAFSLESRSSKKLACRLNDREMAMRAETPSWILPSLDE
G*

Other information
Ka divergence:-0.357769KaKs divergence:-0.152797
GC content 1 (%):65GC content 2 (%):68GC content divergence:0.023
Length 1 (bp):1059Length 2 (bp):1086Length divergence:0.013
MFE 1 (kcal):-425.7MFE 2 (kcal):-481.09MFE divergence0.061