Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074317-GRMZM5G858887
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272382
Function (paralog2):hypothetical protein LOC100191751

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.7913713258159
Log2 mRNA fold difference:2.1745915116134
Log2 TE fold difference:-0.43971575855044
Sequences
Protein sequence

MPRLAFLRRSLPARLLARACGGGGGGDQGSPDQVARDEEAGGSGGMSGRSSAGGPSGGEC
YACTQPGVPAFHSTTCDQVHSPDWDADAGSSLVPVQGQAQAAAAAAAPRQRHAARWLLGP
VLDPRSRRVQRWNRWILLGRAAALAVDPLFFYALSIGRAGQPCLYMDAGLASAVTALRTC
ADVAHLAHVLLQLRLAYVSRESLVVGCGKLVWDARAVAAHYARSVKGLCFDLFVILPIPQ
VIFWLVIPKLIREEQVKLIMTILLLMFIFQFLPKVYHSIHIMRKMQKVTGYIFGSIWWGF
GLNLFAYFIASHIAGGCWYVLAIQRIASCLQEECKRNNSCDLISLACSKEICFHPPWSSN
VNGFACDTNMTSFSQQNVSTCLSGKGSFAYGIYLGALPVISSNSLAVKILYPIFWGLMTL
STFGNDLAPTSNGIEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDMEW
WMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVPL
FHGMDDLILDNICDRLRPLVLSSGEKVIREGDPVQRMVFILQGKLRSTQPLTKGVVATCM
LGAGSFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLGAPDLRFITEHFRYNFAN
EKLKRTARYYSSNWRTWAAVNIQLAWRRYRARTSADLAAPPLVGGPDDGDRRLRHYAAMF
MSLRPHDHLE*

MPPLAFLRRYLPARNRVSVIDPELRLSVCFPEQRLLARACDGGVRGSPGVARDEEAGGSG
GLSGRSAGAPSGECYACTQPGVPAFHSTACDQVHSPDWDADAGSSLVPVQAQQQAQPAAA
AAQHAARWLFGPVLDPRSKRVQRWNRWILLGRAAALALDPLFFYALSIGRAGRPCLYLDA
GLAAAVTALRTCADVAHLAHVLLQFRLAYVSRESLVVGCGKLVWDARAIAAHYARSVKGL
CFDLFVILPIPQVIFWLVIPKLIREERVRLIMTILLLMFIFQFLPKVYHSIHIMRKMQKV
TGYIFGSIWWGFGLNLFAYFIASHIAGGCWYVLAIQRIASCLQEECKKNNSCDLISLACS
KEICFHPPWSSNVNGFACDTNMTSFSQRNVSTCLSGKGSFAYGIYLGALPVISSNSLAVK
ILYPIFWGLMTLSTFGNDLAPTSNGIEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARK
RKMQLRFRDMEWWMRRRQLPSRLRQRVRKYERERWAAVTGDEEMEMIKDLPEGLRRDIKR
YLCLELVKQVPLFHGMDDLILDNICDRLRPLVFSSGEKVIREGDPVQRMVFILQGKLRST
QPLTKGVVATCMLGAGNFLGDELLSWCLRRPFVDRLPASSATFECVEAAQAFCLDAPDLR
FITEHFRYKFANEKLRRTARYYSSNWRTWAAVNIQLAWRRYRARASTDLAAMAAPPLAGG
PDDGDRRLRHYAAMFMSLRPHDHLE*

Other information
Ka divergence:-0.403454KaKs divergence:-0.210419
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):2193Length 2 (bp):2238Length divergence:0.01
MFE 1 (kcal):-1017.21MFE 2 (kcal):-1003.71MFE divergence-0.007