Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074386-GRMZM5G817037
Species:maize
Duplication type:WGD
Function (paralog1):Proteasome subunit beta type (EC 3.4.25.1)
Function (paralog2):proteasome subunit beta type 1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.069216180901389
Log2 mRNA fold difference:-0.75267747557217
Log2 TE fold difference:0.85507961828068
Sequences
Protein sequence

MSRRGDWVYENNGGTCVAIAGADYCVVAADTRLSVGYSILTRDHSKICDLADKCVLASSG
FQGDIKALHKNLAARELLYQHQHNKRMSCPAMAQLLSNTLYYKRFFPYYAFNVLGGLDSE
GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPARDAVTPLSESEAI
DLVKDVFASATERDIYTVSCICSLPKYCACFSFIYIYPVDPQTCKICRETSWKL*

MSRRGDWVYENNGGTCVAIAGADYCVVAADTRLSVGYSILTRDHSKICDLADKCVLASSG
FQGDIKALQKNLAARELLYQHQHNKRMSCPAMAQLLSNTLYYKRFFPYYAFNVLGGLDSE
GKGCVFTYDAVGSYERTGYSAQGTGSTLIMPVLDNQLKSPSPLLLPVRDAVTPLSESEAI
DLVKDVFASATERDIYTGDKLEIVVINKAGTMREYIDLRKD*

Other information
Ka divergence:-0.730539KaKs divergence:-0.782741
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):705Length 2 (bp):666Length divergence:-0.028
MFE 1 (kcal):-220.7MFE 2 (kcal):-211.9MFE divergence-0.02