Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074401-GRMZM2G128971
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):fatty acid desaturase7

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.43551467502545
Log2 mRNA fold difference:0.10385481272423
Log2 TE fold difference:0.24544944535453
Sequences
Protein sequence

MAYVLRDVVVVLGLAAAAARLDSWLVWPLYWAAQGTMFWALFVLGHDCGHGSFSNNPKLN
SVVGHILHSSILVPYHGWRISHRTHHQNHGHVEKDESWHPLPERLYKSLDFMTRKLRFTM
PFPLLAFPLYLFARSPGKSGSHFNPSSDLFQPNEKKDIITSTASWLAMVGVLAGLTFLMG
PVTMLKLYGVPYFVFVAWLDMVTYLHHHGHEDKLPWYRGQEWSYLRGGLTTLDRDYGLIN
NIHHDIGTHVIHHLFPQIPHYHLIEATEAAKPVLGKYYKEPKKSGPLPWHLFGVLAQSLK
QDHYVSDTGDVVYYQTDSKTNTSAQKSD*

MARLVLSECCGLAPLRRLRAGRGAIAAPSPPALSAAPRRRPASASIHRDWALRVSAPTRL
ASAAVEEDKPSAAPGQEEGAAAGGEFDPGAPPPFGLAEIRAAIPKHCWVKDPWRSMSYVL
RDVAVVLGLAAAAARLDSWLVWPLYWAAQGTMFWALFVLGHDCGHGSFSNNPKLNSVVGH
ILHSSILVPYHGWRISHRTHHQNHGHVEKDESWHPLPERLYKSLDFMTRKLRFTMPFPLL
AFPLYLFARSPGKSGSHFNPGSDLFQPTEKNDIITSTASWLAMVGVLAGLTFLMGPVPML
KLYGVPYLVFVAWLDMVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWINNIHHD
IGTHVIHHLFPQIPHYHLIEATEAAKPVLGKYYKEPKKSGALPWHLFRVLAQSLKQDHYV
SDTGDVVYYQAESKTSTSALKSD*

Other information
Ka divergence:0.429727KaKs divergence:-0.135872
GC content 1 (%):53GC content 2 (%):62GC content divergence:0.078
Length 1 (bp):987Length 2 (bp):1332Length divergence:0.149
MFE 1 (kcal):-334.68MFE 2 (kcal):-559.44MFE divergence0.251