Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074404-GRMZM2G099449
Species:maize
Duplication type:WGD
Function (paralog1):transmembrane BAX inhibitor motif-containing protein 4
Function (paralog2):transmembrane BAX inhibitor motif-containing protein 4 (LOC100282793), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.28116119596112
Log2 mRNA fold difference:1.4005507796505
Log2 TE fold difference:-1.6659880936417
Sequences
Protein sequence

MFGYRKADPDLEAGGSSLLYPGMTESPELRWAFVRKIYVILAVQLAMTAAVSAFVVKVPA
VSNFFVSSNAGVALYIFLIILPFLVLCPLRYYHQKHPVNLLLLGLFTVAISFAVGMTCAF
TSGKIILEAAILTAVVVISLTAYTFWAAKRGHDFNFLGPFLFAAIMVLMVFSLIQIFFPL
GKISVMIYGGLASLIFCGYIIYDTDNVIKRYTYDEYIWAAVSLYLDVINLFLSLLQLLRA
ADS*

MFGYRKADPDLEAGGSSLLYPGMTESPELRWAFVRKIYVILTVQLAMTAAVSAFVVKVPA
VSNFFVSSNAGIALYIFLIVLPFIVLCPLHYYHQKHPINLLLLGLFTVAISFAVGMTCAF
TSGKIILEAAILTAVVVNSLTAYTFWAAKRGHDFNFLGPFLIAAIMVLMVFSLIQIFFPL
GKISVMIYGGLASLIFCGYIIYDTDNIIKRHTYDQYIWAAVSLYLDVINLFLSLLQLLRA
ADS*

Other information
Ka divergence:0.637997KaKs divergence:0.804401
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):732Length 2 (bp):732Length divergence:0
MFE 1 (kcal):-244.1MFE 2 (kcal):-256.1MFE divergence0.024