Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074472-GRMZM2G073942
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MVEASPESGAAATGGASSTAAVRKGKSCKGCLYYSSVLKSRGYNPICVGIPRSIPQVPNY
VVDEPKEEATAQGHDLRRFRYGCAGYSMFVDNRDGQGGESEGKTLLPYCRGLELLVDSRL
VERKPSATEQAPAHVAKDAAATIRSHQQGQQRPQNLSRQEFLDRFKRSAGLVASGVAKNL
NKTANYIKENIQDMYTDRRPPK*

MVVGASSVSGAAASGGTSGTAPPRKGKSCKGCLYYSSVLKSRGYNPICVGIPRSIPQVPN
YVVDEPKEDATAQGHDLRRFRYGCAGYSIFVNRDGQGGEGEGKTLLPYCRGLELLVDSRL
VERKPSAAEQAPAHVTKDAAATTRSHQQGQQRPANLSRQEFLERKVTVHSFSLSPAPTRI
YCLADVYGWHRFKKSAGLVASGVAKNLNKTANYIKENIHDILYHDRRPPK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):54GC content divergence:-0.018
Length 1 (bp):609Length 2 (bp):693Length divergence:0.065
MFE 1 (kcal):-223.86MFE 2 (kcal):-247.49MFE divergence0.05