Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074604-GRMZM2G160541
Species:maize
Duplication type:WGD
Function (paralog1):phenylalanine ammonia-lyase
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.148334966236
Log2 mRNA fold difference:-3.4950245868357
Log2 TE fold difference:1.3196899203093
Sequences
Protein sequence

MAGNGAIVESDPLNWGAAAAELAGSHLDEVKRMVAQARQPVVKIEGSTLRVGQVAAVASA
KDASGVAVELDEEARPRVKASSEWILDCIAHGGDIYGVTTGFGGTSHRRTKDGPALQVEL
LRHLNAGIFGTGSDGHTLPSEVTRAAMLVRINTLLQGYSGIRFEILEAITKLLNTGVSPC
LPLRGTITASGDLVPLSYIAGLITGRPNAQAVTVDGRKVDAAEAFKIAGIEGGFFKLNPK
EGLAIVNGTSVGSALAATVMYDANVLAVLSEVLSAVFCEVMNGKPEYTDHLTHKLKHHPG
SIEAAAIMEHILDGSSFMKQAKKLNELDPLLKPKQDRYALRTSPQWLGPQIEVIRAATKS
IEREVNSVNDNPVIDVHRGKALHGGNFQGTPIGVSMDNARLAIANIGKLMFAQFSELVNE
FYNNGLTSNLAGSRNPSLDYGFKGTEIAMASYCSELQYLGNPITNHVQSAEQHNQDVNSL
GLVSARKTAEAIDILKLMSSTYIVALCQAVDLRHLEENIKASVKNTVTQVAKKVLTMNPS
GELSSARFSEKELISAIDREAVFTYAEDAASGSLPLMQKLRAVLVDHALSSGDAEREPSV
FSKITRFEEELRAVLPQEVEAARVAVAEGTAPVANRIADSRSFPLYRFVREELGCVFLTG
ERLKSPGEECNKVFVGISQGKLVDPMLECLKEWDGKPLPINVK*

MAGNGAIVESDPLNWGAAAAELAGSHLDEVKRMVAQARQPVVKIEGSTLRVGQVAAVASA
RDASGVAVELDEEARPRVKASSEWILDCIAHGGDIYGVTTGFGGTSHRRTKDGPALQVEL
LRHLNAGIFGTGSDGHTLPSEVTRAAMLVRINTLLQGYSGIRFEILEAITKLLNTGVSPC
LPLRGTITASGDLVPLSYIAGLITGRPNAQAVTVDGRKVDAAEAFKIAGIEGGFFKLNPK
EGLAIVNGTSVGSALAATVMYDANVLAVLSEVLSAVFCEVMNGKPEYTDHLTHKLKHHPG
SIEAAAIMEHILEGSSFMKHAKKVNELDPLLKPKQDRYALRTSPQWLGPQIEVIRAATKS
IEREVNSVNDNPVIDVHRGKALHGGNFQGTPIGVSMDNARLAIANIGKLMFAQFSELVNE
FYNNGLTSNLAGSRNPSLDYGFKGTEIAMASYCSELQYLGNPITNHVQSAEQHNQDVNSL
GLVSARKTAEAIDILKLMSSTEDIFWCT*

Other information
Ka divergence:0.605967KaKs divergence:0.66113
GC content 1 (%):68GC content 2 (%):67GC content divergence:-0.007
Length 1 (bp):2112Length 2 (bp):1527Length divergence:-0.161
MFE 1 (kcal):-1013.48MFE 2 (kcal):-695.31MFE divergence-0.186