Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G074742-GRMZM5G853479
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.38820019133849
Log2 mRNA fold difference:-0.21095864751212
Log2 TE fold difference:0.55160087003795
Sequences
Protein sequence

MAECKDDDSGRRSPSSSMDSSTHPPALSTASSASRRPPERRDQLSPDLQLGLSLSPASSA
LLVAETNNSIVPSTPRNQALPDWPPIKPFLRSALTASARRRRTLFVKVYMEGVPIGRKLD
MLLLDGYSSLLAKLCHMFKASITYADAVEYHQRVPHEKAAHVLTYEDHDGDWMMVGDVPW
ELFLGSVKKLRIARTDRC*

MEGVAIGRKLDLLLLDGYDSLLAKLRHMFKASITFADAMEYHQRVPHEKPAHVLTYEDRD
GDWMMVGDVPWELFLGSVKKLRICKNR*

Other information
Ka divergence:0.479475KaKs divergence:0.908282
GC content 1 (%):61GC content 2 (%):52GC content divergence:-0.08
Length 1 (bp):597Length 2 (bp):264Length divergence:-0.387
MFE 1 (kcal):-234.93MFE 2 (kcal):-79.2MFE divergence-0.496